PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013620984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 472aa    MW: 53537.4 Da    PI: 7.0048
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013620984.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-103183551954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  XP_013620984.1 318 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 355
                     665559******************************88 PP

2BELL113.98.2e-37181252172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kk+kLl++++eVdkrY+qy++q+++++ss e+ ag+g+akpYts+Al++iSrhFrcL+dai+eq+
  XP_013620984.1 181 ERQELQSKKNKLLTMVDEVDKRYNQYYHQMEALASSIEMGAGVGAAKPYTSVALNRISRHFRCLRDAIKEQV 252
                     79********************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.5E-46122250IPR006563POX domain
PfamPF075267.9E-44128248IPR006563POX domain
PROSITE profilePS5007112.422296359IPR001356Homeobox domain
CDDcd000861.53E-11299360No hitNo description
SMARTSM003896.5E-10299363IPR001356Homeobox domain
SuperFamilySSF466897.27E-18300367IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28302365IPR009057Homeodomain-like
PfamPF059205.7E-18316355IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MAVYYPTSTV GMQSLYQEPI YLNEQASSSS AGAGANCLEI PNSVPNEMVF IPPTSDTSLN  60
GNVTVSSNDL SFHGGGLSLS LGNQIQYHYQ NLSNQLSYNE ENGKSHHHQH HHQVPSFGFY  120
NNGFVSSVLR SRYLKPTQQL LDEVVSVKKT KNNEKGQDFT NGSKPNDTNN TENNEELSPS  180
ERQELQSKKN KLLTMVDEVD KRYNQYYHQM EALASSIEMG AGVGAAKPYT SVALNRISRH  240
FRCLRDAIKE QVLVIRGKLG EKETAEEQGE RIPRLRYLDQ RLRQQRALHQ QLGMVRPTWR  300
PQRGLPENSV SILRAWLFEH FLHPYPKESE KIMLAKQTGL SKNQVANWFI NARVRLWKPM  360
IEEMYKEEFG DSSELLSNSN QGSSSSNKKN RMNETSQLKH EDTSSSQQQN HGNNNIPYTS  420
DAEENLIFAD PKPDSLMNYN GFGVVDYNGY TGLGNQQDGR FSNPHQLHDF VV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16305363563Homeobox protein Meis2
3k2a_B3e-16305363563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620984.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_013620986.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A0D3AQP40.0A0A0D3AQP4_BRAOL; Uncharacterized protein
STRINGBra008197.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3